Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNA Ligase I was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DNA Ligase I was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14418A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNA Ligase I |
| Target Synonyms | LIGI; IMD96; hLig1; DNA Ligase I | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human DNA Ligase I (P18858). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEEEDEALSPAKGQKPALDCSQVS | Uniprot ID | P18858 |
Uniprot Id
P18858
Target Species
Human
Target Name
LIG1
Target Full Name
DNA ligase 1
Target Function
DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair.
Target Subcellular Location
Nucleus.
Target Protein Families
ATP-dependent DNA ligase family
Target Research Area
Cell Cycle
Target Synonyms
DNA ligase 1; DNA ligase I; DNLI1_HUMAN; LIG 1; lig1; Ligase I DNA ATP dependent; MGC117397; MGC130025; Polydeoxyribonucleotide synthase [ATP] 1
Target Background
This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
