-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Galectin 8/LGALS8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 8/LGALS8 (O00214) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Galectin 8/LGALS8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 8/LGALS8 (O00214) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13855A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Galectin 8/LGALS8 |
| Target Synonyms | Gal-8; PCTA1; PCTA-1; Po66-CBP; Galectin 8/LGALS8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 8/LGALS8 (O00214). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKRE | Uniprot ID | O00214 |
Uniprot Id
O00214
Target Species
Human
Target Name
LGALS8
Target Full Name
Galectin-8
Target Function
Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.
Target Subcellular Location
Cytoplasmic vesicle. Cytoplasm, cytosol.
Target Tissue Specificity
Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
Target Synonyms
Gal 8; Gal-8; Gal8; Galectin 8; Galectin-8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8 ; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP ; Po66-CBP; Prostate carcinoma tumor antigen 1
Target Background
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification