Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Guanylyl Cyclase beta 1 (GUCY1B3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (GUCY1B3) (Q02153) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Guanylyl Cyclase beta 1 (GUCY1B3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (GUCY1B3) (Q02153) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16200A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Guanylyl Cyclase beta 1 (GUCY1B3) |
| Target Synonyms | GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1; Guanylyl Cyclase beta 1 (GUCY1B3) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (GUCY1B3) (Q02153). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN | Uniprot ID | Q02153 |
Uniprot Id
Q02153
Target Species
Human
Target Name
GUCY1B1
Target Full Name
Guanylate cyclase soluble subunit beta-1
Target Function
Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Target Tissue Specificity
Detected in brain cortex and cerebellum (at protein level).
Target Synonyms
GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1; Guanylyl Cyclase beta 1 (GUCY1B3)
Target Background
This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
