-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDAC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HDAC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16026A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDAC4 |
| Target Synonyms | HD4; AHO3; BDMR; HDACA; HA6116; HDAC-4; HDAC-A; NEDCHF; NEDCHID; HDAC4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, THP-1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL | Uniprot ID | P56524 |
Uniprot Id
P56524
Target Species
Human
Target Name
HDAC4
Target Full Name
Histone deacetylase 4
Target Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Deacetylates HSPA1A and HSPA1B at 'Lys-77' leading to their preferential binding to co-chaperone STUB1.
Target Involvement
Brachydactyly-mental retardation syndrome (BDMR)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Histone deacetylase family, HD type 2 subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
AHO3; BDMR; EC 3.5.1.98; HA6116; HD 4; HD4; HDAC 4; HDAC A; HDAC4; HDAC4_HUMAN; HDACA; Histone deacetylase 4; Histone Deacetylase A; KIAA0288
Target Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.
Notification