Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Hippocalcin (HPCA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Hippocalcin (HPCA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14243A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Hippocalcin (HPCA) |
| Target Synonyms | BDR2; DYT2; Hippocalcin (HPCA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, MCF7, Mouse testis, PC-12 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQK | Uniprot ID | P84074 |
Uniprot Id
P84074
Target Species
Human
Target Name
HPCA
Target Full Name
Neuron-specific calcium-binding protein hippocalcin
Target Function
Calcium-binding protein that may play a role in the regulation of voltage-dependent calcium channels. May also play a role in cyclic-nucleotide-mediated signaling through the regulation of adenylate and guanylate cyclases.
Target Involvement
Dystonia 2, torsion, autosomal recessive (DYT2)
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein.
Target Protein Families
Recoverin family
Target Tissue Specificity
Brain specific.
Target Research Area
Others
Target Synonyms
BDR 2; BDR2; Calcium binding protein BDR 2; Calcium binding protein BDR2; Calcium-binding protein BDR-2; HPCA; HPCA_HUMAN; Neuron specific calcium binding protein hippocalcin; Neuron-specific calcium-binding protein hippocalcin; P23K
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
