-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL13RA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL13RA1 (P78552) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IL13RA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL13RA1 (P78552) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13195A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL13RA1 |
| Target Synonyms | NR4; CT19; CD213A1; IL-13Ra; IL13RA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, Hep G2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL13RA1 (P78552). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGS | Uniprot ID | P78552 |
Uniprot Id
P78552
Target Species
Human
Target Name
IL13RA1
Target Full Name
Interleukin-13 receptor subunit alpha-1
Target Function
Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Type I cytokine receptor family, Type 5 subfamily
Target Tissue Specificity
Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
Target Synonyms
IL13RA1; IL13R; IL13RA; Interleukin-13 receptor subunit alpha-1; IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL-13R-alpha-1; IL-13RA1; Cancer/testis antigen 19; CT19; CD antigen CD213a1
Target Background
The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
Notification