-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13211A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITPA |
| Target Synonyms | DEE35; My049; ITPase; NTPase; C20orf37; dJ794I6.3; HLC14-06-P; ITPA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFG | Uniprot ID | Q9BY32 |
Uniprot Id
Q9BY32
Target Species
Human
Target Name
ITPA
Target Full Name
Inosine triphosphate pyrophosphatase
Target Function
Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.
Target Involvement
Inosine triphosphate pyrophosphohydrolase deficiency (ITPAD); Epileptic encephalopathy, early infantile, 35 (EIEE35)
Target Subcellular Location
Cytoplasm.
Target Protein Families
HAM1 NTPase family
Target Tissue Specificity
Ubiquitous. Highly expressed in heart, liver, sex glands, thyroid and adrenal gland.
Target Research Area
Signal Transduction
Target Synonyms
C20orf37; dJ794I6.3; HLC14-06-P; Inosine triphosphatase (nucleoside triphosphate pyrophosphatase); Inosine triphosphatase; inosine triphosphatase-A; Inosine triphosphate pyrophosphatase; Inosine triphosphate pyrophosphohydrolase; Itpa; ITPA_HUMAN; ITPase; My049; My049 protein; Non canonical purine NTP pyrophosphatase; Non standard purine NTP pyrophosphatase; NTPase; nucleoside triphosphate diphosphatase; Nucleoside triphosphate pyrophosphatase; OK/SW-cl.9; OTTHUMP00000030094; OTTHUMP00000160459; Putative oncogene protein hlc14-06-p
Target Background
This gene encodes an inosine triphosphate pyrophosphohydrolase. The encoded protein hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. This protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency which causes an accumulation of ITP in red blood cells. Alternate splicing results in multiple transcript variants.
Notification