-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JAB1/CSN5/COPS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
The antibody against JAB1/CSN5/COPS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-16045A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JAB1/CSN5/COPS5 |
| Target Synonyms | CSN5; JAB1; SGN5; MOV-34; JAB1/CSN5/COPS5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, Mouse testis, Rat testis | Application | ELISA, WB, ChIP, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV | Uniprot ID | Q92905 |
Uniprot Id
Q92905
Target Species
Human
Target Name
COPS5
Target Full Name
COP9 signalosome complex subunit 5
Target Function
Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Cytoplasm, perinuclear region. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.
Target Protein Families
Peptidase M67A family, CSN5 subfamily
Target Synonyms
38 kDa Mov34 homolog; COP9 (constitutive photomorphogenic) homolog subunit 5; COP9 constitutive photomorphogenic homolog subunit 5; COP9 signalosome complex subunit 5; COP9 signalosome subunit 5; Cop9 subunit 5; COPS 5; cops5; CSN 5; CSN5; CSN5_HUMAN; JAB 1; Jun activation domain binding protein 1; Jun activation domain binding protein; Jun activation domain-binding protein 1; MGC3149; MOV 34; MOV34; MOV34 family; 38-KD member; SGN 5; SGN5; Signalosome subunit 5
Target Background
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.
Notification