-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Kappa light chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Kappa light chain (P01601) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Kappa light chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Kappa light chain (P01601) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14408A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Kappa light chain |
| Target Synonyms | HCAK 1; Kappa light chain | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Kappa light chain (P01601). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP | Uniprot ID | P01601 |
Uniprot Id
P01601
Target Species
Human
Target Name
IGKV1D-16
Target Full Name
Immunoglobulin kappa variable 1D-16
Target Function
V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen
Target Subcellular Location
Secreted. Cell membrane.
Target Synonyms
IGKV1D-16; Immunoglobulin kappa variable 1D-16; Ig kappa chain V-I region HK146; Ig kappa chain V-I region HK189
Notification