-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against L-Plastin/LCP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against L-Plastin/LCP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14423A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | L-Plastin/LCP1 |
| Target Synonyms | LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN; L-Plastin/LCP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV | Uniprot ID | P13796 |
Uniprot Id
P13796
Target Species
Human
Target Name
LCP1
Target Full Name
Plastin-2
Target Function
Actin-binding protein. Plays a role in the activation of T-cells in response to costimulation through TCR/CD3 and CD2 or CD28. Modulates the cell surface expression of IL2RA/CD25 and CD69.
Target Involvement
Chromosomal aberrations involving LCP1 is a cause of B-cell non-Hodgkin lymphomas (B-cell NHL). Translocation t(3;13)(q27;q14), with BCL6.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell junction. Cell projection. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Detected in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia, in spleen and other lymph node-containing organs. Expressed in peripheral blood T-lymphocytes, neutrophils, monocytes, B-lymphocytes, and myeloid cells.
Target Research Area
Cancer
Target Synonyms
CP64; L plastin; L-plastin; Larval cuticle protein 1; LC64P; LCP-1; LCP1; LPL; Lplastin; Lymphocyte cytosolic protein 1; Plastin 2; Plastin-2; PLS2; PLSL_HUMAN
Target Background
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
Notification