Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAD3/MXD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3/MXD3 (Q9BW11) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAD3/MXD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3/MXD3 (Q9BW11) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14283A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAD3/MXD3 |
| Target Synonyms | MYX; MAD3; BHLHC13; MAD3/MXD3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, DU-145, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3/MXD3 (Q9BW11). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGF | Uniprot ID | Q9BW11 |
Uniprot Id
Q9BW11
Target Species
Human
Target Name
MXD3
Target Full Name
Max dimerization protein 3
Target Function
Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHc13; Class C basic helix-loop-helix protein 13; FLJ35523; Likely ortholog of mouse Max dimerization protein 3; MAD3_HUMAN; MAX dimerization protein 3; Max dimerizer 3; Max-associated protein 3; Max-interacting transcriptional repressor MAD3; MGC2383; mxd3; Myx; OTTHUMP00000223596; OTTHUMP00000223598
Target Background
This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
