-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mast Cell Chymase (CMA1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Mast Cell Chymase (CMA1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13758A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Mast Cell Chymase (CMA1) |
| Target Synonyms | CYH; MCT1; chymase; Mast Cell Chymase (CMA1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A549, Rat lung, Rat small intestine | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN | Uniprot ID | P23946 |
Uniprot Id
P23946
Target Species
Human
Target Name
CMA1
Target Full Name
Chymase
Target Function
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Target Subcellular Location
Secreted. Cytoplasmic granule. Note=Mast cell granules.
Target Protein Families
Peptidase S1 family, Granzyme subfamily
Target Tissue Specificity
Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.
Target Research Area
Cardiovascular
Target Synonyms
Alpha-chymase; Chymase 1; Chymase 1 mast cell; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; Chymase; Chymase; heart; Chymase; mast cell; CMA1; CMA1_HUMAN; CYH; CYM; EC 3.4.21.39; Mast cell chymase 1; Mast cell protease 3; Mast cell protease 5; Mast cell protease I; Mast cell protease III; Mcp-5; MCP3P; Mcpt5; MCT1; MGC119890; MGC119891; MMCP-5
Target Background
This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.
Notification