Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Monoamine Oxidase A (MAOA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Monoamine Oxidase A (MAOA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16889A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Monoamine Oxidase A (MAOA) |
| Target Synonyms | BRNRS; MAO-A; Monoamine Oxidase A (MAOA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Mouse brain, Mouse lung, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 428-527 of human Monoamine Oxidase A (MAOA) (P21397). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS | Uniprot ID | P21397 |
Uniprot Id
P21397
Target Species
Human
Target Name
MAOA
Target Full Name
Amine oxidase [flavin-containing] A
Target Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
Target Involvement
Brunner syndrome (BRNRS)
Target Subcellular Location
Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side.
Target Protein Families
Flavin monoamine oxidase family
Target Tissue Specificity
Heart, liver, duodenum, blood vessels and kidney.
Target Synonyms
MAOA; Amine oxidase [flavin-containing] A; Monoamine oxidase type A; MAO-A
Target Background
This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
