-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NSD3/WHSC1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NSD3/WHSC1L1 (Q9BZ95) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NSD3/WHSC1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NSD3/WHSC1L1 (Q9BZ95) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13779A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NSD3/WHSC1L1 |
| Target Synonyms | KMT3F; KMT3G; WHISTLE; WHSC1L1; pp14328; NSD3/WHSC1L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A549, Mouse brain, Mouse liver, Mouse testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NSD3/WHSC1L1 (Q9BZ95). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYPATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGF | Uniprot ID | Q9BZ95 |
Uniprot Id
Q9BZ95
Target Species
Human
Target Name
NSD3
Target Full Name
Histone-lysine N-methyltransferase NSD3
Target Function
Histone methyltransferase. Preferentially dimethylates 'Lys-4' and 'Lys-27' of histone H3 forming H3K2me2 and H3K27me2. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Target Involvement
Defects in NSD3 may be involved in non small cell lung carcinomas (NSCLC). Amplified or overexpressed in NSCLC.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SET2 subfamily
Target Tissue Specificity
Highly expressed in brain, heart and skeletal muscle. Expressed at lower level in liver and lung.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DKFZp667H044; FLJ20353; Histone lysine N methyltransferase NSD3; Histone-lysine N-methyltransferase NSD3; MGC126766; MGC142029; NSD 3; NSD3_HUMAN; Nuclear set domain containing 3; Nuclear SET domain containing protein 3; Nuclear SET domain-containing protein 3; pp14328; Protein whistle; Whistle; WHSC1 like protein 1; WHSC1-like 1 isoform 9 with methyltransferase activity to lysine; WHSC1-like protein 1; WHSC1L1; WHSC1L1 protein; Wolf Hirschhorn syndrome candidate 1 like 1; Wolf-Hirschhorn syndrome candidate 1-like protein 1
Target Background
This gene is related to the Wolf-Hirschhorn syndrome candidate-1 gene and encodes a protein with PWWP (proline-tryptophan-tryptophan-proline) domains. This protein methylates histone H3 at lysine residues 4 and 27, which represses gene transcription. Two alternatively spliced variants have been described.
Notification