-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI3 Kinase p85 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI3 Kinase p85 beta (O00459) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PI3 Kinase p85 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI3 Kinase p85 beta (O00459) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15865A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI3 Kinase p85 beta |
| Target Synonyms | p85; MPPH; P85B; MPPH1; p85beta; p85-BETA; PI3 Kinase p85 beta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI3 Kinase p85 beta (O00459). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE | Uniprot ID | O00459 |
Uniprot Id
O00459
Target Species
Human
Target Name
PIK3R2
Target Full Name
Phosphatidylinositol 3-kinase regulatory subunit beta
Target Function
Regulatory subunit of phosphoinositide-3-kinase (PI3K), a kinase that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Indirectly regulates autophagy. Promotes nuclear translocation of XBP1 isoform 2 in a ER stress- and/or insulin-dependent manner during metabolic overloading in the liver and hence plays a role in glucose tolerance improvement.
Target Involvement
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 1 (MPPH1)
Target Protein Families
PI3K p85 subunit family
Target Research Area
Immunology
Target Synonyms
p85; p85 beta; P85B; P85B_HUMAN; Phosphatidylinositol 3 kinase; Phosphatidylinositol 3 kinase regulatory beta subunit ; Phosphatidylinositol 3 kinase regulatory subunit beta; Phosphatidylinositol 3 kinase regulatory subunit polypeptide 2; Phosphatidylinositol 3 kinase; regulatory subunit; polypeptide 2 (p85 beta); Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta; Phosphatidylinositol 3-kinase regulatory subunit beta; Phosphoinositide 3 kinase regulatory subunit 2 (beta); Phosphoinositide 3 kinase regulatory subunit 2; Phosphoinositide 3 kinase regulatory subunit polypeptide 2 (p85 beta); Phosphoinositide 3 kinase regulatory subunit polypeptide 2; Phosphoinositide 3 kinase; regulatory subunit 2 (beta); Phosphoinositide 3 kinase; regulatory subunit 2 (p85 beta); PI3 kinase p85 beta subunit ; PI3 kinase p85 subunit beta; PI3-kinase regulatory subunit beta; PI3-kinase subunit p85-beta; PI3K; PI3K regulatory subunit beta; PIK3R 2; PIK3R2; PtdIns 3 kinase p85 beta; PtdIns-3-kinase regulatory subunit beta; PtdIns-3-kinase regulatory subunit p85-beta
Target Background
Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Three transcript variants, one protein coding and the other two non-protein coding, have been found for this gene.
Notification