-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLGF (P49763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PLGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLGF (P49763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13419A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLGF |
| Target Synonyms | PGFL; PIGF; PLGF; PlGF-2; D12S1900; SHGC-10760 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLGF (P49763). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETA | Uniprot ID | P49763 |
Uniprot Id
P49763
Target Species
Human
Target Name
PGF
Target Full Name
Placenta growth factor
Target Function
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
Target Subcellular Location
Secreted. Note=The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
Target Protein Families
PDGF/VEGF growth factor family
Target Tissue Specificity
While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
Target Research Area
Cardiovascular
Target Synonyms
D12S1900; Pgf; PGFL; PIGF; Placenta growth factor; Placental growth factor; Placental growth factor; vascular endothelial growth factor related protein; PlGF 2; PlGF; PLGF_HUMAN; PlGF2; SHGC 10760
Target Background
Enables growth factor activity. Involved in positive regulation of cell population proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Biomarker of several diseases, including artery disease (multiple); autoimmune disease of musculoskeletal system (multiple); epilepsy (multiple); limited scleroderma; and pancreatic endocrine carcinoma.
Notification