-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMA/FOLH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PSMA/FOLH1 (NP_004467.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PSMA/FOLH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PSMA/FOLH1 (NP_004467.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14822A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMA/FOLH1 |
| Target Synonyms | PSM; FGCP; FOLH; GCP2; PSMA; mGCP; GCPII; NAALAD1; PSMA/FOLH1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LNCaP | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PSMA/FOLH1 (NP_004467.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPG | Uniprot ID | Q04609 |
Uniprot Id
Q04609
Target Species
Human
Target Name
FOLH1
Target Full Name
Glutamate carboxypeptidase 2
Target Function
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Isoform PSMA']: Cytoplasm.
Target Protein Families
Peptidase M28 family, M28B subfamily
Target Tissue Specificity
Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kid
Target Synonyms
Cell growth inhibiting protein 27 ; Cell growth-inhibiting gene 27 protein; FGCP; Folate hydrolase (prostate-specific membrane antigen) 1; Folate hydrolase 1; Folate hydrolase; Folate hydrolase prostate specific membrane antigen 1; FOLH 1; FOLH; Folh1; FOLH1_HUMAN; Folylpoly gamma glutamate carboxypeptidase; Folylpoly-gamma-glutamate carboxypeptidase; GCP 2; GCP II; GCP2; GCPII; GIG27; Glutamate carboxylase II; Glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; mGCP; N acetylated alpha linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; NAALAD 1; NAALAD1; NAALAdase; NAALADase I; Prostate specific membrane antigen; Prostate specific membrane antigen variant F; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly gamma glutamate carboxypeptidase; Pteroylpoly-gamma-glutamate carboxypeptidase
Target Background
This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms.
Notification