Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pyrophosphatase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Pyrophosphatase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13472A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pyrophosphatase 1 |
| Target Synonyms | PP; PP1; IOPPP; HEL-S-66p; SID6-8061; Pyrophosphatase 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse large intestine, Mouse liver, OVCAR3, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT | Uniprot ID | Q15181 |
Uniprot Id
Q15181
Target Species
Human
Target Name
PPA1
Target Full Name
Inorganic pyrophosphatase
Target Subcellular Location
Cytoplasm.
Target Protein Families
PPase family
Target Tissue Specificity
Expressed ubiquitously.
Target Research Area
Others
Target Synonyms
cytosolic inorganic pyrophosphatase; diphosphate phosphohydrolase; inorganic diphosphatase; inorganic pyrophosphatase 1; Inorganic pyrophosphatase; IOPPP; IPYR_HUMAN; PP; PP1; PPA1; PPase; Pyp; pyrophosphatase, inorganic, 1; Pyrophosphate phospho hydrolase; Pyrophosphate phospho-hydrolase; SID6-8061
Target Background
The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
