-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Recoverin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Recoverin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15728A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Recoverin |
| Target Synonyms | RCV1; RCVRN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with Recoverin (Human) | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA | Uniprot ID | P35243 |
Uniprot Id
P35243
Target Species
Human
Target Name
RCVRN
Target Full Name
Recoverin
Target Function
Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light.
Target Subcellular Location
Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment. Photoreceptor outer segment membrane; Lipid-anchor; Cytoplasmic side. Perikaryon.
Target Protein Families
Recoverin family
Target Tissue Specificity
Retina and pineal gland.
Target Research Area
Neuroscience
Target Synonyms
23 kDa photoreceptor cell-specific protein; Cancer associated retinopathy protein; Cancer-associated retinopathy protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; RECO_HUMAN; Recoverin; S-modulin
Target Background
This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.
Notification