-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3B3/SAP130 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SF3B3/SAP130 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14051A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3B3/SAP130 |
| Target Synonyms | RSE1; SAP130; SF3b130; STAF130; SF3B3/SAP130 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse testis, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF | Uniprot ID | Q15393 |
Uniprot Id
Q15393
Target Species
Human
Target Name
SF3B3
Target Full Name
Splicing factor 3B subunit 3
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
Target Subcellular Location
Nucleus.
Target Protein Families
RSE1 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
KIAA0017; Pre mRNA splicing factor SF3b 130 kDa subunit; Pre-mRNA-splicing factor SF3b 130 kDa subunit; RSE1; SAP 130; SAP130 ; SF3b130; SF3B3; SF3B3_HUMAN; Spliceosome associated protein 130 ; Spliceosome-associated protein 130; Splicing factor 3b subunit 3 130kD; Splicing factor 3B subunit 3; STAF130
Target Background
This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.
Notification