-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUPT5H/SPT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SUPT5H/SPT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14379A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUPT5H/SPT5 |
| Target Synonyms | SPT5; SPT5H; Tat-CT1; SUPT5H/SPT5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H/SPT5 (O00267). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG | Uniprot ID | O00267 |
Uniprot Id
O00267
Target Species
Human
Target Name
SUPT5H
Target Full Name
Transcription elongation factor SPT5
Target Function
Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences
Target Subcellular Location
Nucleus.
Target Protein Families
SPT5 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DRB sensitivity inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; DRB sensitivity-inducing factor large subunit; DSIF large subunit; DSIF p160; FLJ34157; hSPT 5; hSPT5; SPT 5; SPT 5H; SPT5; SPT5H; SPT5H_HUMAN; Suppressor of Ty 5 homolog; Suppressor of Ty 5 homolog (S. cerevisiae); SUPT 5H; supt5h; Tat cotransactivator 1 protein; Tat CT1; Tat CT1 protein; Tat-cotransactivator 1 protein; Tat-CT1 protein; Transcription elongation factor SPT 5; Transcription elongation factor spt5; Transcription factor Tat CT1
Notification