Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thymidine Kinase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thymidine Kinase 1 (P04183) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Thymidine Kinase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thymidine Kinase 1 (P04183) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13782A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thymidine Kinase 1 |
| Target Synonyms | TK2; Thymidine Kinase 1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thymidine Kinase 1 (P04183). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQ | Uniprot ID | P04183 |
Uniprot Id
P04183
Target Species
Human
Target Name
TK1
Target Full Name
Thymidine kinase, cytosolic
Target Subcellular Location
Cytoplasm.
Target Protein Families
Thymidine kinase family
Target Synonyms
TK2; Thymidine Kinase 1
Target Background
The protein encoded by this gene is a cytosolic enzyme that catalyzes the addition of a gamma-phosphate group to thymidine. This creates dTMP and is the first step in the biosynthesis of dTTP, which is one component required for DNA replication. The encoded protein, whose levels fluctuate depending on the cell cycle stage, can act as a low activity dimer or a high activity tetramer. High levels of this protein have been used as a biomarker for diagnosing and categorizing many types of cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
