-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Troponin I2 (TNNI2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Troponin I2 (TNNI2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16076A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Troponin I2 (TNNI2) |
| Target Synonyms | DA2B; FSSV; DA2B1; fsTnI; AMCD2B; Troponin I2 (TNNI2) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES | Uniprot ID | P48788 |
Uniprot Id
P48788
Target Species
Human
Target Name
TNNI2
Target Full Name
Troponin I, fast skeletal muscle
Target Function
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Target Involvement
Arthrogryposis, distal, 2B (DA2B)
Target Protein Families
Troponin I family
Target Synonyms
AMCD 2B; AMCD2B; DA 2B; DA2B; fast skeletal muscle; Fast twitch skeletal muscle troponin I; fast-twitch isoform; FSSV; fsTnI; TNNI 2; Tnni2; TNNI2_HUMAN; tro; Troponin I; Troponin I fast skeletal muscle; Troponin I fast twitch 2; Troponin I fast twitch isoform; Troponin I fast twitch skeletal muscle isoform; Troponin I skeletal fast; Troponin I type 2 (skeletal fast); Troponin I type 2
Target Background
This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene.
Notification