-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP7/HAUSP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human USP7/HAUSP (Q93009) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against USP7/HAUSP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human USP7/HAUSP (Q93009) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16571A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP7/HAUSP |
| Target Synonyms | TEF1; HAUSP; HAFOUS; DEL16P13.2; C16DELp13.2; USP7/HAUSP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, MCF7, Mouse brain, Mouse testis, PC-3, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human USP7/HAUSP (Q93009). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAP | Uniprot ID | Q93009 |
Uniprot Id
Q93009
Target Species
Human
Target Name
USP7
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 7
Target Function
Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN, KMT2E/MLL5 and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Deubiquitinates KMT2E/MLL5 preventing KMT2E/MLL5 proteasomal-mediated degradation. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1. Deubiquitinates alkylation repair enzyme ALKBH3. OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions. Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like complex. Able to mediate deubiquitination of histone H2B; it is however unsure whether this activity takes place in vivo. Exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function. Plays a role in the maintenance of the circadian clock periodicity via deubiquitination and stabilization of the CRY1 and CRY2 proteins. Deubiquitinates REST, thereby stabilizing REST and promoting the maintenance of neural progenitor cells. Deubiquitinates SIRT7, inhibiting SIRT7 histone deacetylase activity and regulating gluconeogenesis.; (Microbial infection) Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus, PML body. Chromosome. Note=Present in a minority of ND10 nuclear bodies. Association with ICP0/VMW110 at early times of infection leads to an increased proportion of USP7-containing ND10. Colocalizes with ATXN1 in the nucleus. Colocalized with DAXX in speckled structures. Colocalized with PML and PTEN in promyelocytic leukemia protein (PML) nuclear bodies.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Expressed in neural progenitor cells (at protein level). Widely expressed. Overexpressed in prostate cancer.
Target Research Area
Cell Biology
Target Synonyms
Deubiquitinating enzyme 7; HAUSP; Herpes virus associated ubiquitin specific protease; Herpesvirus-associated ubiquitin-specific protease; TEF 1; tef-1; TEF1; Ubiquitin carboxyl terminal hydrolase 7; Ubiquitin carboxyl-terminal hydrolase 7; Ubiquitin specific peptidase 7 (herpes virus associated); Ubiquitin specific peptidase 7; Ubiquitin specific peptidase 7 herpes virus associated; Ubiquitin specific processing protease 7; Ubiquitin specific protease 7 (herpes virus associated); Ubiquitin specific protease 7; Ubiquitin specific protease 7 herpes virus associated; Ubiquitin thioesterase 7; Ubiquitin thiolesterase 7; Ubiquitin-specific-processing protease 7; UBP 7; UBP-7; UBP7; UBP7_HUMAN; USP 7; usp-7; Usp7; VMW110-ASSOCIATED PROTEIN, 135-KD
Target Background
The protein encoded by this gene belongs to the peptidase C19 family, which includes ubiquitinyl hydrolases. This protein deubiquitinates target proteins such as p53 (a tumor suppressor protein) and WASH (essential for endosomal protein recycling), and regulates their activities by counteracting the opposing ubiquitin ligase activity of proteins such as HDM2 and TRIM27, involved in the respective process. Mutations in this gene have been implicated in a neurodevelopmental disorder.
Notification