-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Xanthine Oxidase (XDH) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Xanthine Oxidase (XDH) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14000A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Xanthine Oxidase (XDH) |
| Target Synonyms | XO; XOR; XAN1; Xanthine Oxidase (XDH) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG | Uniprot ID | P47989 |
Uniprot Id
P47989
Target Species
Human
Target Name
XDH
Target Full Name
Xanthine dehydrogenase/oxidase
Target Function
Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid. Contributes to the generation of reactive oxygen species. Has also low oxidase activity towards aldehydes (in vitro).
Target Involvement
Xanthinuria 1 (XAN1)
Target Subcellular Location
Cytoplasm. Peroxisome. Secreted.
Target Protein Families
Xanthine dehydrogenase family
Target Tissue Specificity
Detected in milk (at protein level).
Target Synonyms
Xanthine dehydrogenase; Xanthine dehydrogenase/oxidase; Xanthine oxidase; Xanthine oxidoreductase; XD; XDH; XDH_HUMAN; xdha; XO; xor
Target Background
Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.
Notification