-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZBTB7A/FBI-1/LRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/FBI-1/LRF (O95365) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ZBTB7A/FBI-1/LRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/FBI-1/LRF (O95365) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14226A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZBTB7A/FBI-1/LRF |
| Target Synonyms | LRF; FBI1; FBI-1; TIP21; ZBTB7; MNDLFH; ZNF857A; pokemon; ZBTB7A/FBI-1/LRF | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/FBI-1/LRF (O95365). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASP | Uniprot ID | O95365 |
Uniprot Id
O95365
Target Species
Human
Target Name
ZBTB7A
Target Full Name
Zinc finger and BTB domain-containing protein 7A
Target Function
Transcription factor that represses the transcription of a wide range of genes involved in cell proliferation and differentiation. Directly and specifically binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3' and represses transcription both by regulating the organization of chromatin and through the direct recruitment of transcription factors to gene regulatory regions. Negatively regulates SMAD4 transcriptional activity in the TGF-beta signaling pathway through these two mechanisms. That is, recruits the chromatin regulator HDAC1 to the SMAD4-DNA complex and in parallel prevents the recruitment of the transcriptional activators CREBBP and EP300. Collaborates with transcription factors like RELA to modify the accessibility of gene transcription regulatory regions to secondary transcription factors. Also directly interacts with transcription factors like SP1 to prevent their binding to DNA. Functions as an androgen receptor/AR transcriptional corepressor by recruiting NCOR1 and NCOR2 to the androgen response elements/ARE on target genes. Thereby, negatively regulates androgen receptor signaling and androgen-induced cell proliferation. Involved in the switch between fetal and adult globin expression during erythroid cells maturation. Through its interaction with the NuRD complex regulates chromatin at the fetal globin genes to repress their transcription. Specifically represses the transcription of the tumor suppressor ARF isoform from the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation. Regulates chondrogenesis through the transcriptional repression of specific genes via a mechanism that also requires histone deacetylation. Regulates cell proliferation through the transcriptional regulation of genes involved in glycolysis. Involved in adipogenesis through the regulation of genes involved in adipocyte differentiation. Plays a key role in the differentiation of lymphoid progenitors into B and T lineages. Promotes differentiation towards the B lineage by inhibiting the T-cell instructive Notch signaling pathway through the specific transcriptional repression of Notch downstream target genes. Also regulates osteoclast differentiation. May also play a role, independently of its transcriptional activity, in double-strand break repair via classical non-homologous end joining/cNHEJ. Recruited to double-strand break sites on damage DNA, interacts with the DNA-dependent protein kinase complex and directly regulates its stability and activity in DNA repair. May also modulate the splicing activity of KHDRBS1 toward BCL2L1 in a mechanism which is histone deacetylase-dependent and thereby negatively regulates the pro-apoptotic effect of KHDRBS1.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Widely expressed. In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level). In tonsil, expressed in squamous epithelium and germinal center lymphocytes (at protein level). Up-regulated in a subset of lymphomas,
Target Synonyms
Factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI 1; FBI-1; FBI1; HIV 1 1st binding protein 1; HIV-1 1st-binding protein 1; Leukemia/lymphoma related factor; Leukemia/lymphoma-related factor; LRF; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF I interacting peptide 21; TTF-I-interacting peptide 21; ZBT7A_HUMAN; ZBTB7; ZBTB7A; Zinc finger and BTB domain containing protein 7A; Zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A
Target Background
Enables several functions, including SMAD binding activity; androgen receptor binding activity; and transcription corepressor binding activity. Involved in several processes, including erythrocyte maturation; negative regulation of signal transduction; and regulation of nucleobase-containing compound metabolic process. Located in cytoplasm and nucleus. Colocalizes with DNA-dependent protein kinase complex and NuRD complex.
Notification