Rabbit anti- MEK1/MEK2 Monoclonal Antibody

The antibody against MEK1/MEK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

ADA-15498A

Number

Order Exclusive Products Now

Request a Quote

High Purity LevelsPrecision and ReliabilityCustomization Options

Product Gallery

Western blot analysis of lysates from HeLa cells, using MEK1/MEK2 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Specifications

Cat.No	ADA-15498A	Clonality	Monoclonal
Host Species	Rabbit	Target Name	MEK1/MEK2
Target Synonyms	CFC3; MAPKK1; MEK1; MKK1; PRKMK1; MEK1/MEK2	Form	Liquid
Species Reactivity	Human, Mouse, Rat	Isotype	IgG
Storage Buffer	50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3.	Purification Method	Affinity purification
Positive Samples	HeLa	Application	ELISA, WB, IHC-P

Immunogen Information

Immunogen Description	A synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1).	Immunogen Sequence	SIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKE
Uniprot ID	Q02750, P36507

Inquire Rabbit anti- MEK1/MEK2 Monoclonal Antibody Now

Full Name *

Business Email Address *

Phone

Products/Services

Catalog Number

Quantity (μg, mg, g, μl, ml, L, kit)

Address

Project Description

AbTriva respects your privacy and protects your personal data in accordance with AbTriva. For more information, please see our data protection statement. *

Submit