-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFN gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-153 of rat IFN gamma (NP_620235.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFN gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-153 of rat IFN gamma (NP_620235.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16396A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFN gamma |
| Target Synonyms | If2f; IFNG2; IFN gamma | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Recombinant Mouse/Rat IFN-gamma Protein | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-153 of rat IFN gamma (NP_620235.1). | Target Species | Rat |
|---|---|---|---|
| Immunogen Sequence | CYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKR | Uniprot ID | P01581 |
Uniprot Id
P01581
Target Species
Rat
Target Name
IFNG
Target Full Name
Interferon gamma
Target Function
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Target Subcellular Location
Secreted.
Target Protein Families
Type II (or gamma) interferon family
Target Tissue Specificity
Released primarily from activated T lymphocytes.
Target Synonyms
If2f; IFNG2; IFN gamma
Target Background
Predicted to enable cytokine activity. Involved in several processes, including negative regulation of cell population proliferation; positive regulation of NMDA glutamate receptor activity; and positive regulation of macromolecule metabolic process. Located in several cellular components, including extracellular space; neuron projection; and perikaryon. Used to study several diseases, including Chagas disease; allergic conjunctivitis; allergic rhinitis; renal fibrosis; and ureteral obstruction. Biomarker of several diseases, including abdominal aortic aneurysm; autoimmune thyroiditis; pulpitis; tongue squamous cell carcinoma; and visual epilepsy. Human ortholog(s) of this gene implicated in several diseases, including ataxia telangiectasia; autoimmune disease (multiple); eczema herpeticum; factor VIII deficiency; and leukemia (multiple). Orthologous to human IFNG (interferon gamma).
Notification