-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USO1 (O60763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against USO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USO1 (O60763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13322A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USO1 |
| Target Synonyms | TAP; VDP; P115; USO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, K-562, MCF7, Mouse thymus, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USO1 (O60763). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEE | Uniprot ID | O60763 |
Uniprot Id
O60763
Target Species
Human
Target Name
USO1
Target Full Name
General vesicular transport factor p115
Target Function
General vesicular transport factor required for intercisternal transport in the Golgi stack; it is required for transcytotic fusion and/or subsequent binding of the vesicles to the target membrane. May well act as a vesicular anchor by interacting with the target membrane and holding the vesicular and target membranes in proximity.
Target Subcellular Location
Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein.
Target Protein Families
VDP/USO1/EDE1 family
Target Synonyms
General vesicular transport factor; General vesicular transport factor p115; P115; Protein USO1 homolog; TAP; Transcytosis associated protein; Transcytosis-associated protein; Uso1; USO1_HUMAN; VDP; Vesicle docking protein; Vesicle docking protein p115; Vesicle-docking protein
Target Background
The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants.
Notification