-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Osteopontin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Osteopontin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13639A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Osteopontin |
| Target Synonyms | OPN; BNSP; BSPI; ETA-1; Osteopontin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Jurkat, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF | Uniprot ID | P10451 |
Uniprot Id
P10451
Target Species
Human
Target Name
SPP1
Target Full Name
Osteopontin
Target Function
Major non-collagenous bone protein that binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.; Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity.
Target Subcellular Location
Secreted.
Target Protein Families
Osteopontin family
Target Tissue Specificity
Bone. Found in plasma.
Target Research Area
Cancer
Target Synonyms
BNSP; Bone sialoprotein 1; Bone sialoprotein I; BSP I; BSPI; Early T lymphocyte activation 1; ETA 1; ETA1; MGC110940; Nephropontin; OPN; Osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; OSTP_HUMAN; PSEC0156; secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1); secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); Secreted phosphoprotein 1; SPP 1; SPP-1; SPP1; SPP1/CALPHA1 fusion; Urinary stone protein; Uropontin
Target Background
The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
Notification