-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAD2B/MAD2L2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2B/MAD2L2 (Q9UI95) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MAD2B/MAD2L2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2B/MAD2L2 (Q9UI95) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13895A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAD2B/MAD2L2 |
| Target Synonyms | REV7; FANCV; MAD2B; POLZ2; MAD2B/MAD2L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Mouse testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2B/MAD2L2 (Q9UI95). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQ | Uniprot ID | Q9UI95 |
Uniprot Id
Q9UI95
Target Species
Human
Target Name
MAD2L2
Target Full Name
Mitotic spindle assembly checkpoint protein MAD2B
Target Function
Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end resection. Mediates various NHEJ-dependent processes including immunoglobulin class-switch recombination, and fusion of unprotected telomeres. May also regulate another aspect of cellular response to DNA damage through regulation of the JNK-mediated phosphorylation and activation of the transcriptional activator ELK1. Inhibits the FZR1- and probably CDC20-mediated activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Regulates TCF7L2-mediated gene transcription and may play a role in epithelial-mesenchymal transdifferentiation.
Target Involvement
Fanconi anemia, complementation group V (FANCV)
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm. Chromosome.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Homolog of REV7 S cerevisiae; hREV7; MAD2 (mitotic arrest deficient yeast, homolog) like 2; MAD2 homolog; MAD2 like 2; MAD2 mitotic arrest deficient like 2; MAD2-like protein 2; MAD2B ; Mad2l2; MD2L2_HUMAN; Mitotic Arrest Deficient 2 L2; Mitotic arrest deficient 2-like protein 2; Mitotic arrest deficient homolog like 2; Mitotic arrest deficient like 2 (yeast) ; Mitotic arrest deficient yeast homolog; Mitotic spindle assembly checkpoint protein MAD2B; Polymerase (DNA directed) zeta 2 accessory subunit; POLZ2; REV 7; REV7; REV7 homolog; Weakly similar to Mitotic MAD2 protein (S cerevisiae)
Target Background
The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins.
Notification