-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELMO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 628-727 of human ELMO1 (Q92556) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ELMO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 628-727 of human ELMO1 (Q92556) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14176A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELMO1 |
| Target Synonyms | CED12; CED-12; ELMO-1; ELMO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung, Raji, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 628-727 of human ELMO1 (Q92556). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN | Uniprot ID | Q92556 |
Uniprot Id
Q92556
Target Species
Human
Target Name
ELMO1
Target Full Name
Engulfment and cell motility protein 1
Target Function
Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Translocation to plasma membrane seems to be mediated by DOCK1 and CRK.
Target Tissue Specificity
Widely expressed, with a higher expression in the spleen and placenta.
Target Synonyms
CED 12; Ced 12 homolog 1; Ced 12 homolog; CED-12; CED12; Ced12 homolog 1; Ced12 homolog; ELMO 1; ELMO-1; Elmo1; ELMO1_HUMAN; Engulfment and cell motility 1; Engulfment and cell motility protein 1; KIAA0281; MGC126406; Protein ced-12 homolog
Target Background
This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants.
Notification