Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Prolactin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolactin Receptor (P16471) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Prolactin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolactin Receptor (P16471) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14299A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Prolactin Receptor |
| Target Synonyms | HPRL; MFAB; hPRLrI; RI-PRLR; Prolactin Receptor | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, Hep G2, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolactin Receptor (P16471). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYI | Uniprot ID | P16471 |
Uniprot Id
P16471
Target Species
Human
Target Name
PRLR
Target Full Name
Prolactin receptor
Target Function
This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
Target Involvement
Multiple fibroadenomas of the breast (MFAB); Hyperprolactinemia (HPRL)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 7]: Secreted.
Target Protein Families
Type I cytokine receptor family, Type 1 subfamily
Target Tissue Specificity
Expressed in breast, placenta, kidney, liver and pancreas.
Target Synonyms
PRLR; Prolactin receptor; PRL-R
Target Background
This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
