Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CEND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CEND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14313A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CEND1 |
| Target Synonyms | BM88; CEND1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKK | Uniprot ID | Q8N111 |
Uniprot Id
Q8N111
Target Species
Human
Target Name
CEND1
Target Full Name
Cell cycle exit and neuronal differentiation protein 1
Target Function
Involved in neuronal differentiation.
Target Subcellular Location
Membrane; Single-pass type IV membrane protein.
Target Protein Families
CEND1 family
Target Tissue Specificity
Neuron specific.
Target Synonyms
CEND1; BM88; Cell cycle exit and neuronal differentiation protein 1; BM88 antigen
Target Background
The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
