Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-493 of human PRD (NP_000276.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-493 of human PRD (NP_000276.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14562A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRD |
| Target Synonyms | PROLIDASE; PRD | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse small intestine, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-493 of human PRD (NP_000276.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK | Uniprot ID | P12955 |
Uniprot Id
P12955
Target Species
Human
Target Name
PEPD
Target Full Name
Xaa-Pro dipeptidase
Target Function
Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
Target Involvement
Prolidase deficiency (PD)
Target Protein Families
Peptidase M24B family, Eukaryotic-type prolidase subfamily
Target Synonyms
Aminoacyl L proline hydrolase; Imidodipeptidase; MGC10905; MGC95081; Pep 4; Pep4; pepD; PEPD_HUMAN; Peptidase 4; Peptidase D; Prolidase; Proline dipeptidase; X pro dipeptidase; X-Pro dipeptidase; Xaa-Pro dipeptidase
Target Background
This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
