-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ATR (NP_001175.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ATR (NP_001175.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14778A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATR |
| Target Synonyms | FRP1; MEC1; SCKL; FCTCS; SCKL1; ATR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ATR (NP_001175.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLT | Uniprot ID | Q13535 |
Uniprot Id
Q13535
Target Species
Human
Target Name
ATR
Target Full Name
Serine/threonine-protein kinase ATR
Target Function
Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates BRCA1, CHEK1, MCM2, RAD17, RPA2, SMC1 and p53/TP53, which collectively inhibit DNA replication and mitosis and promote DNA repair, recombination and apoptosis. Phosphorylates 'Ser-139' of histone variant H2AX at sites of DNA damage, thereby regulating DNA damage response mechanism. Required for FANCD2 ubiquitination. Critical for maintenance of fragile site stability and efficient regulation of centrosome duplication. Positively regulates the restart of stalled replication forks following activation by the KHDC3L-OOEP scaffold complex.
Target Involvement
Seckel syndrome 1 (SCKL1); Cutaneous telangiectasia and cancer syndrome, familial (FCTCS)
Target Subcellular Location
Nucleus. Chromosome. Note=Depending on the cell type, it can also be found in PML nuclear bodies. Recruited to chromatin during S-phase. Redistributes to discrete nuclear foci upon DNA damage, hypoxia or replication fork stalling.
Target Protein Families
PI3/PI4-kinase family, ATM subfamily
Target Tissue Specificity
Ubiquitous, with highest expression in testis. Isoform 2 is found in pancreas, placenta and liver but not in heart, testis and ovary.
Target Synonyms
Ataxia telangiectasia and Rad3 related; Ataxia telangiectasia and Rad3-related protein; ATR; ATR_HUMAN; FCTCS; FRAP Related Protein 1; FRAP-related protein 1; FRP1; MEC1; MEC1 mitosis entry checkpoint 1 homolog; Protein kinase ATR; RAC3; Rad3 related protein; SCKL; SCKL1; Serine/threonine protein kinase ATR; Serine/threonine-protein kinase ATR
Target Background
The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.
Notification