Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Endomucin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 212-261 of human Endomucin (NP_057326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against Endomucin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 212-261 of human Endomucin (NP_057326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of Endomucin in paraffin-embedded mouse kidney using Endomucin Rabbit mAb at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-14989A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Endomucin |
| Target Synonyms | EMCN2; MUC14; Endomucin | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 212-261 of human Endomucin (NP_057326.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN | Uniprot ID | Q9ULC0 |
Uniprot Id
Q9ULC0
Target Species
Human
Target Name
EMCN
Target Full Name
Endomucin
Target Function
Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Consistently localized to the plasma membrane and less abundantly to Golgi-like perinuclear stacks.; [Isoform 2]: Secreted.
Target Tissue Specificity
Expressed in heart, kidney and lung.
Target Synonyms
EMCN; EMCN2; Endomucin 2; Endomucin; Endomucin-2; Endothelial sialomucin; Gastric cancer antigen Ga34; MUC-14; MUC14; MUCEN_HUMAN; Mucin 14; Mucin-14
Target Background
EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
