-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glutathione Synthetase (GSS) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Glutathione Synthetase (GSS) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15821A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glutathione Synthetase (GSS) |
| Target Synonyms | GSHS; HEL-S-64p; HEL-S-88n; Glutathione Synthetase (GSS) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, HepG2, Mouse liver, Mouse lung, Rat kidney, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR | Uniprot ID | P48637 |
Uniprot Id
P48637
Target Species
Human
Target Name
GSS
Target Full Name
Glutathione synthetase
Target Function
Catalyzes the production of glutathione from gamma-glutamylcysteine and glycine in an ATP-dependent manner. Glutathione (gamma-glutamylcysteinylglycine, GSH) is the most abundant intracellular thiol in living aerobic cells and is required for numerous processes including the protection of cells against oxidative damage, amino acid transport, the detoxification of foreign compounds, the maintenance of protein sulfhydryl groups in a reduced state and acts as a cofactor for a number of enzymes.
Target Involvement
Glutathione synthetase deficiency (GSS deficiency); Glutathione synthetase deficiency of erythrocytes (GLUSYNDE)
Target Protein Families
Eukaryotic GSH synthase family
Target Synonyms
epididymis secretory sperm binding protein Li 64p; epididymis secretory sperm binding protein Li 88n; Glutathione synthase; Glutathione synthetase; GSH S; GSH synthetase; GSH-S; GSHB_HUMAN; GSHS; GSS; HEL-S-64p; HEL-S-88n; MGC14098; OTTHUMP00000030711
Target Background
Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.
Notification