-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ETS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15959A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETS1 |
| Target Synonyms | p54; ETS-1; EWSR2; c-ets-1; ETS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Jurkat, MCF7, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM | Uniprot ID | P14921 |
Uniprot Id
P14921
Target Species
Human
Target Name
ETS1
Target Full Name
Protein C-ets-1
Target Function
Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Highly expressed within lymphoid cells. Isoforms c-ETS-1A and Ets-1 p27 are both detected in all fetal tissues tested, but vary with tissue type in adult tissues. None is detected in brain or kidney.
Target Synonyms
Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; C ets 1 protein; c-ets-1; ETS 1; Ets protein; ETS proto-oncogene 1; transcription factor; ETS1; ETS1 oncogene; ETS1 protein; ETS1_HUMAN; EWSR 2; EWSR2; FLJ10768; Oncogene ETS1; P54; Protein C-ets-1; v ets avian erythroblastosis virus E2 oncogene homolog ; v ets avian erythroblastosis virus E2 oncogene homolog 1; v ets avian erythroblastosis virus E26 oncogene homolog 1; v ets erythroblastosis virus E26 oncogene homolog 1 ; v-ets erythroblastosis virus E26 oncogene homolog 1
Target Background
This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification