-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GST3/GSTP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GST3/GSTP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15972A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GST3/GSTP1 |
| Target Synonyms | PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22; GST3/GSTP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung, PC-3 cells, Rat kidney, TE-1 cells, U-251MG cells | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN | Uniprot ID | P09211 |
Uniprot Id
P09211
Target Species
Human
Target Name
GSTP1
Target Full Name
Glutathione S-transferase P
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Target Subcellular Location
Cytoplasm. Mitochondrion. Nucleus. Note=The 83 N-terminal amino acids function as un uncleaved transit peptide, and arginine residues within it are crucial for mitochondrial localization.
Target Protein Families
GST superfamily, Pi family
Target Research Area
Metabolism
Target Synonyms
Deafness; Deafness X-linked 7; DFN7; FAEES3; Fatty Acid Ethyl Ester Synthase III ; Glutathione S Transferase 3; Glutathione S Transferase Pi; Glutathione S-transferase P; Glutathione S-transferase pi 1; GST class-pi; GST3; GSTP; Gstp1; GSTP1-1; GSTP1_HUMAN; PI; X linked 7
Target Background
Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Notification