-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Folate Binding Protein(FBP) / FOLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Folate Binding Protein(FBP) / FOLR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16511A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Folate Binding Protein(FBP) / FOLR1 |
| Target Synonyms | FBP; FOLR; NCFTD; FRalpha; Folate Binding Protein(FBP) / FOLR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF | Uniprot ID | P15328 |
Uniprot Id
P15328
Target Species
Human
Target Name
FOLR1
Target Full Name
Folate receptor alpha
Target Function
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.
Target Involvement
Neurodegeneration due to cerebral folate transport deficiency (NCFTD)
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Cytoplasmic vesicle. Cytoplasmic vesicle, clathrin-coated vesicle. Endosome. Apical cell membrane. Note=Endocytosed into cytoplasmic vesicles and then recycled to the cell membrane.
Target Protein Families
Folate receptor family
Target Tissue Specificity
Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium.
Target Synonyms
adult; Adult folate binding protein; Adult folate-binding protein; FBP; Folate Binding Protein; Folate Receptor 1 Adult; Folate receptor 1; Folate Receptor 1 Precursor; Folate receptor adult; Folate receptor alpha; Folate receptor; FOLR; FOLR1; FOLR1_HUMAN; FR alpha; FR-alpha; FRalpha ; KB cells FBP; MOV18; Ovarian cancer associated antigen ; Ovarian tumor associated antigen ; Ovarian tumor associated antigen MOv18; Ovarian tumor-associated antigen MOv18
Target Background
The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.
Notification