-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 14-3-3 alpha/beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 147-246 of human 14-3-3 alpha/beta (P31946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against 14-3-3 alpha/beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 147-246 of human 14-3-3 alpha/beta (P31946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14022A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 14-3-3 alpha/beta |
| Target Synonyms | HS1; GW128; YWHAA; KCIP-1; HEL-S-1; 14-3-3 alpha/beta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, NIH/3T3, Rat brain, A549, HT-29, Jurkat, Mouse brain, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 147-246 of human 14-3-3 alpha/beta (P31946). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN | Uniprot ID | P31946 |
Uniprot Id
P31946
Target Species
Human
Target Name
YWHAB
Target Full Name
14-3-3 protein beta/alpha
Target Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
Target Subcellular Location
Cytoplasm. Melanosome.
Target Protein Families
14-3-3 family
Target Research Area
Signal Transduction
Target Synonyms
14 3 3; 14 3 3 protein beta; 14 3 3 protein beta/alpha; 14 3 3 protein zeta; 14 3 3 zeta; 14-3-3 protein beta/alpha; 14-3-3 protein/cytosolic phospholipase A2; 1433B_HUMAN; GW128; HS1; KCIP 1; KCIP-1; MGC111427; MGC126532; MGC138156; N-terminally processed; Protein 1054; Protein kinase C inhibitor protein 1; Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; delta polypeptide; Tyrosine 3/tryptophan 5 -monooxygenase activation protein; zeta polypeptide; YWHAB; YWHAD; YWHAZ
Target Background
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene.
Notification