-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against 4-1BBL/CD137L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against 4-1BBL/CD137L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14102A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 4-1BBL/CD137L |
| Target Synonyms | CD137L; TNLG5A; 4-1BB-L; 4-1BBL/CD137L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse lung, Raji, Rat lung, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE | Uniprot ID | P41273 |
Uniprot Id
P41273
Target Species
Human
Target Name
TNFSF9
Target Full Name
Tumor necrosis factor ligand superfamily member 9
Target Function
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Expressed in brain, placenta, lung, skeletal muscle and kidney.
Target Research Area
Immunology
Target Synonyms
4 1BB L; 4 1BB ligand; 4 1BBL; 4-1BB ligand; 4-1BBL; Cd137l; Cd157l; Homolog of mouse 4 1BB L; Homolog of mouse 4 1BBL; ILA ligand (TNF related); Ly63l; Receptor 4 1BB ligand; TNF superfamily member 9; TNFL9_HUMAN; Tnfsf9; TNLG5A; Tumor necrosis factor (ligand) superfamily member 9; Tumor necrosis factor ligand 5A; Tumor necrosis factor ligand superfamily member 9; Tumor necrosis factor superfamily member 9
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
Notification