-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACADS / SCAD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACADS / SCAD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13340A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACADS / SCAD |
| Target Synonyms | SCAD; ACAD3; ACADS / SCAD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, Jurkat, Mouse liver, Mouse skeletal muscle, Rat liver, Rat skeletal muscle | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS | Uniprot ID | P16219 |
Uniprot Id
P16219
Target Species
Human
Target Name
ACADS
Target Full Name
Short-chain specific acyl-CoA dehydrogenase, mitochondrial
Target Function
Short-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats. The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA. Among the different mitochondrial acyl-CoA dehydrogenases, short-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 4 to 6 carbons long primary chains.
Target Involvement
Acyl-CoA dehydrogenase short-chain deficiency (ACADSD)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Acyl-CoA dehydrogenase family
Target Synonyms
ACAD3; ACADS; ACADS_HUMAN; Acyl Coenzyme A dehydrogenase; C2 to C3 short chain; Acyl-CoA dehydrogenase; C2 to C3 short chain; Acyl-CoA dehydrogenase; short chain; Acyl-Coenzyme A dehydrogenase; short chain; AI196007; Bcd-1; Bcd1; Butyryl CoA dehydrogenase; Butyryl-CoA dehydrogenase; EC 1.3.99.2; mitochondrial; SCAD; Short chain acyl CoA dehydrogenase; Short-chain specific acyl-CoA dehydrogenase; Short-chain specific acyl-CoA dehydrogenase; mitochondrial; Unsaturated acyl CoA reductase
Target Background
This gene encodes a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with short-chain acyl-CoA dehydrogenase (SCAD) deficiency. Alternative splicing results in two variants which encode different isoforms.
Notification