-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 328-427 of human ACAT1 (P24752) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 328-427 of human ACAT1 (P24752) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15875A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACAT1 |
| Target Synonyms | T2; MAT; ACAT; THIL; ACAT1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293T, A549, DU-145, Hep G2, Rat kidney, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 328-427 of human ACAT1 (P24752). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQKL | Uniprot ID | P24752 |
Uniprot Id
P24752
Target Species
Human
Target Name
ACAT1
Target Full Name
Acetyl-CoA acetyltransferase, mitochondrial
Target Function
This is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA. Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms. The activity of the enzyme is reversible and it can also catalyze the condensation of two acetyl-CoA molecules into acetoacetyl-CoA. Thereby, it plays a major role in ketone body metabolism.
Target Involvement
3-ketothiolase deficiency (3KTD)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Thiolase family
Target Research Area
Metabolism
Target Synonyms
ACAT 1; ACAT; acat1; Acetoacetyl CoA thiolase; acetoacetyl Coenzyme A thiolase; Acetoacetyl-CoA thiolase; Acetyl CoA acetyltransferase; mitochondrial ; Acetyl Coenzyme A acetyltransferase 1; Acetyl-CoA acetyltransferase; acetyl-coa acetyltransferase precursor; mitochondrial ; Acetyl-CoA thiolase; mitochondrial; acetyl-Coenzyme A acetyltransferase 1; MAT; mitochondrial acetoacetyl-CoA thiolase; mitochondrial; RATACAL; T2; testicular tissue protein Li 198; THIL; THIL_HUMAN
Target Background
This gene encodes a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. Defects in this gene are associated with 3-ketothiolase deficiency, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.
Notification