-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAM15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ADAM15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16110A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAM15 |
| Target Synonyms | MDC15; ADAM15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT 116 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS | Uniprot ID | Q13444 |
Uniprot Id
Q13444
Target Species
Human
Target Name
ADAM15
Target Full Name
Disintegrin and metalloproteinase domain-containing protein 15
Target Function
Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain.
Target Subcellular Location
Endomembrane system; Single-pass type I membrane protein. Cell junction, adherens junction. Cell projection, cilium, flagellum. Cytoplasmic vesicle, secretory vesicle, acrosome.
Target Tissue Specificity
Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothelium and smooth musc
Target Research Area
Cancer
Target Synonyms
A disintegrin and metalloproteinase domain 15 (metargidin); A disintegrin and metalloproteinase domain 15; ADA15_HUMAN; ADAM 15; ADAM metallopeptidase domain 15; Adam15; and cysteine-rich protein 15; Disintegrin and metalloproteinase domain-containing protein 15; disintegrin-like; EC 3.4.24.; MDC 15; MDC-15; MDC15; Metalloprotease RGD disintegrin protein; Metalloproteinase like disintegrin like and cysteine rich protein 15; Metalloproteinase-like; Metargidin
Target Background
The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification