-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALDH1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14923A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aldh1a1 |
| Target Synonyms | ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e; ALDH1A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 (NP_000680.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ | Uniprot ID | P00352 |
Uniprot Id
P00352
Target Species
Human
Target Name
ALDH1A1
Target Full Name
Aldehyde dehydrogenase 1A1
Target Function
Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid. Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid. This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic. Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification. Functions also downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins. Has also an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission.
Target Subcellular Location
Cytoplasm, cytosol. Cell projection, axon.
Target Protein Families
Aldehyde dehydrogenase family
Target Tissue Specificity
Expressed by erythrocytes (at protein level).
Target Synonyms
Acetaldehyde dehydrogenase 1; AHD2; AL1A1_HUMAN; ALDC; Aldehyde dehydrogenase 1 family member A1; Aldehyde dehydrogenase 1 soluble; Aldehyde dehydrogenase 1A1; Aldehyde dehydrogenase; Aldehyde dehydrogenase cytosolic; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase liver cytosolic; ALDH 1; ALDH 1A1; ALDH class 1; ALDH; liver cytosolic; ALDH-E1; ALDH1 A1; ALDH1; ALDH11; ALDH1A1; ALHDII; cytosolic; epididymis luminal protein 12; epididymis luminal protein 9; epididymis secretory sperm binding protein Li 53e; HEL-S-53e; MGC2318; PUMB1; RALDH 1; RalDH1; Retinal dehydrogenase 1
Target Background
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
Notification