-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alpha Internexin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Alpha Internexin (Q16352) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Alpha Internexin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Alpha Internexin (Q16352) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14180A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alpha Internexin |
| Target Synonyms | NEF5; NF66; NF-66; TXBP-1; Alpha Internexin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Alpha Internexin (Q16352). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE | Uniprot ID | Q16352 |
Uniprot Id
Q16352
Target Species
Human
Target Name
INA
Target Full Name
Alpha-internexin
Target Function
Class-IV neuronal intermediate filament that is able to self-assemble. It is involved in the morphogenesis of neurons. It may form an independent structural network without the involvement of other neurofilaments or it may cooperate with NEFL to form the filamentous backbone to which NEFM and NEFH attach to form the cross-bridges. May also cooperate with the neuronal intermediate filament protein PRPH to form filamentous networks.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Found predominantly in adult CNS.
Target Synonyms
66 kDa neurofilament protein; AINX_HUMAN; Alpha Inx; Alpha-internexin; Alpha-Inx; INA; Internexin neuronal intermediate filament protein alpha ; MGC12702; NEF 5; NEF5; Neurofilament 5 (66kD); Neurofilament 5; Neurofilament 66; Neurofilament 66 tax binding protein ; Neurofilament-66; NF 66; NF-66; NF66 ; TXBP 1; TXBP1
Target Background
Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
Notification