Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALS2CR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALS2CR1 (Q9GZT8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALS2CR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALS2CR1 (Q9GZT8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13213A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALS2CR1 |
| Target Synonyms | CALS-7; MDS015; ALS2CR1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, DU-145, Hep G2, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALS2CR1 (Q9GZT8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL | Uniprot ID | Q9GZT8 |
Uniprot Id
Q9GZT8
Target Species
Human
Target Name
NIF3L1
Target Full Name
NIF3-like protein 1
Target Function
May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
GTP cyclohydrolase I type 2/NIF3 family
Target Synonyms
ALS2CR1; Amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 1; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 1 protein; CALS-7; MDS015; Ngg1 interacting factor 3-like 1; NIF3 (Ngg1 interacting factor 3, S.pombe homolog)-like 1; NIF3 NGG1 interacting factor 3-like 1 (S. pombe); NIF3 NGG1 interacting factor 3-like 1; NIF3-like protein 1; NIF3L_HUMAN; Nif3l1; OTTHUMP00000206190 ; OTTHUMP00000206191 ; OTTHUMP00000206192
Target Background
Enables identical protein binding activity. Involved in positive regulation of transcription, DNA-templated. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
