-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Annexin A4/Annexin IV was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A4/Annexin A4/Annexin IV (P09525) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Annexin A4/Annexin IV was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A4/Annexin A4/Annexin IV (P09525) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14028A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Annexin A4/Annexin IV |
| Target Synonyms | ANX4; P32.5; PIG28; PP4-X; ZAP36; PAP-II; HEL-S-274; Annexin A4/Annexin IV | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, BxPC-3, Rat kidney, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A4/Annexin A4/Annexin IV (P09525). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMK | Uniprot ID | P09525 |
Uniprot Id
P09525
Target Species
Human
Target Name
ANXA4
Target Full Name
Annexin A4
Target Function
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Target Subcellular Location
Zymogen granule membrane; Peripheral membrane protein.
Target Protein Families
Annexin family
Target Research Area
Cardiovascular
Target Synonyms
35 beta calcimedin; 35-beta calcimedin; AIV; Annexin 4; Annexin A4; Annexin IV (placental anticoagulant protein II); Annexin IV; Annexin IV placental anticoagulant protein II; Annexin-4; AnnexinA4; AnnexinIV; ANX 4; ANX A4; ANX4; ANXA 4; ANXA4; ANXA4 protein; ANXA4_HUMAN; Carbohydrate binding protein P33/P41; Carbohydrate-binding protein p33/p41; Chromobindin 4; Chromobindin-4; Chromobindin4; DKFZp686H02120; Endonexin I; EndonexinI; Lipocortin IV; LipocortinIV; MGC75105; OTTHUMP00000160052; OTTHUMP00000202207; P32.5; P33/41; PAP II; PAP-II; PAPII; PIG 28; PIG28; Placental anticoagulant protein II; PP4 X; PP4-X; PP4X; Proliferation inducing gene 28; Proliferation inducing protein 28; Protein II; Xanx-4; ZAP 36; ZAP36
Target Background
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.
Notification